PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla014424
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family TALE
Protein Properties Length: 275aa    MW: 31131.1 Da    PI: 6.6213
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla014424genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-092032372155
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                k +yps++++  LA+++gL+++q+ +WF N+R ++
  Cla014424 203 KWPYPSESQKLALAQSTGLDQKQINNWFINQRKRH 237
                569*****************************885 PP

2ELK41.62.6e-14157178122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK qLlrKYsgyLgsLkqEF+
  Cla014424 157 ELKGQLLRKYSGYLGSLKQEFM 178
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.3E-192064IPR005540KNOX1
PfamPF037903.3E-222260IPR005540KNOX1
SMARTSM012564.9E-2469120IPR005541KNOX2
PfamPF037913.1E-2072118IPR005541KNOX2
SMARTSM011882.8E-8157178IPR005539ELK domain
PROSITE profilePS5121311.174157177IPR005539ELK domain
PfamPF037894.2E-11157178IPR005539ELK domain
PROSITE profilePS5007113.005177240IPR001356Homeobox domain
SuperFamilySSF466891.2E-19179253IPR009057Homeodomain-like
SMARTSM003897.7E-13179244IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-28182242IPR009057Homeodomain-like
CDDcd000862.86E-12189241No hitNo description
PfamPF059204.4E-17197236IPR008422Homeobox KN domain
PROSITE patternPS000270215238IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MDENNNNNNE GSNGGGNSCC EVKAKIMAHP HYHRLLAAYV NCRKVGAPPE VVARLEEVCA  60
SAAIMSGNSS GCIGEDPALD QFMEAYCEML TKYEQELSKP FRDAMLFLQR IDSQFKALSI  120
SSSHAAACGE AFDRNGSSEE EVDINGNSID PQAEDRELKG QLLRKYSGYL GSLKQEFMKK  180
RKKGKLPKEA RQQLLDWWSR HYKWPYPSES QKLALAQSTG LDQKQINNWF INQRKRHWKP  240
SEDMQFVVMD AAHPQYYMDT VLGNPFPLDI SPTLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172181LKQEFMKKRK
2178182KKRKK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818754e-88LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132624e-88LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004134981.21e-176PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466081e-148HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0A0KJU41e-176A0A0A0KJU4_CUCSA; Uncharacterized protein
STRINGVIT_10s0116g00190.t011e-155(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-136KNOX/ELK homeobox transcription factor